PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00125771001
Common NameGSBRNA2T00125771001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 263aa    MW: 28783.1 Da    PI: 6.9773
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00125771001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.49e-30117169255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          +rl+Wtp+LH+rFv++v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  GSBRNA2T00125771001 117 ARLVWTPQLHKRFVDVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 169
                          79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.317113172IPR017930Myb domain
SuperFamilySSF466893.4E-19114173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-30115174IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-23117169IPR006447Myb domain, plants
PfamPF002494.1E-8119168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGEEVRMKDV SGDGDRVMEW EKGLPSDEDL ASLSYSLVPW NLAMAFSITP EKSRTIQDVN  60
RASETTFSSL RGGSSGPNTS SSTNLGKQKI SEDAAGVEIS TAEEGDSGTE DLKLKRARLV  120
WTPQLHKRFV DVVAHLGIKN AVPKTIMQLM NVEGLTRENV ASHLQKYRLY LKRMQGLTSE  180
GPSSSDKLFS STPVPPQSFQ DLVYAHHMGM QGYHHQNHAH DPYHQNHHRG SGGPANPYMM  240
QQNKFGSMAS YPPVGGGSAN EN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-19115174463ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.87041e-88seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00125771001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603089.10.0PREDICTED: transcription factor LUX-like
RefseqXP_013671998.10.0PREDICTED: transcription factor LUX-like
SwissprotQ9SNB41e-150PCL1_ARATH; Transcription factor LUX
TrEMBLA0A078BW270.0A0A078BW27_BRANA; BnaC01g24700D protein
STRINGBra033809.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.21e-141G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]